Anti-SF3B6
Catalog Number:
ATA-HPA034830
- Images (9)
| Article Name: | Anti-SF3B6 |
| Biozol Catalog Number: | ATA-HPA034830 |
| Supplier Catalog Number: | HPA034830 |
| Alternative Catalog Number: | ATA-HPA034830-100,ATA-HPA034830-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CGI-110, Ht006, P14, SAP14a, SF3B14a |
| splicing factor 3b, subunit 6, 14kDa |
| Anti-SF3B6 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 51639 |
| UniProt: | Q9Y3B4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SF3B6 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human breast and skeletal muscle tissues using Anti-SF3B6 antibody. Corresponding SF3B6 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human breast, kidney, lymph node and skeletal muscle using Anti-SF3B6 antibody HPA034830 (A) shows similar protein distribution across tissues to independent antibody HPA034829 (B). |
|
|
Immunohistochemical staining of human breast shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Immunohistochemical staining of human kidney using Anti-SF3B6 antibody HPA034830. |
|
|
Immunohistochemical staining of human lymph node using Anti-SF3B6 antibody HPA034830. |
|
|
HPA034830-100ul |
|
|
HPA034830-100ul |
|
|
HPA034830-100ul |
Product Guarantee and Expert Support
