Anti-STK17B Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA034858
Artikelname: Anti-STK17B Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA034858
Hersteller Artikelnummer: HPA034858
Alternativnummer: ATA-HPA034858-100,ATA-HPA034858-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DRAK2
serine/threonine kinase 17b
Anti-STK17B
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 9262
UniProt: O94768
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ICLSHSWLQQWDFENLFHPEETSSSSQTQDHSVRSSEDKTSKSSCNGTCGDREDKENIPEDSSMVSKRFRFDDSLPNPHELVSDLL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: STK17B
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human tonsil and skeletal muscle tissues using Anti-STK17B antibody. Corresponding STK17B RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Immunohistochemical staining of human tonsil shows high expression.
Western blot analysis in control (vector only transfected HEK293T lysate) and STK17B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401355).
HPA034858
HPA034858
HPA034858