Anti-STK17B

Catalog Number: ATA-HPA034858
Article Name: Anti-STK17B
Biozol Catalog Number: ATA-HPA034858
Supplier Catalog Number: HPA034858
Alternative Catalog Number: ATA-HPA034858-100,ATA-HPA034858-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DRAK2
serine/threonine kinase 17b
Anti-STK17B
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 9262
UniProt: O94768
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ICLSHSWLQQWDFENLFHPEETSSSSQTQDHSVRSSEDKTSKSSCNGTCGDREDKENIPEDSSMVSKRFRFDDSLPNPHELVSDLL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: STK17B
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human tonsil and skeletal muscle tissues using Anti-STK17B antibody. Corresponding STK17B RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Immunohistochemical staining of human tonsil shows high expression.
Western blot analysis in control (vector only transfected HEK293T lysate) and STK17B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401355).
HPA034858-100ul
HPA034858-100ul
HPA034858-100ul