Anti-UBA3
Artikelnummer:
ATA-HPA034874
- Bilder (9)
| Artikelname: | Anti-UBA3 |
| Artikelnummer: | ATA-HPA034874 |
| Hersteller Artikelnummer: | HPA034874 |
| Alternativnummer: | ATA-HPA034874-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | hUba3, NAE2, UBE1C |
| ubiquitin-like modifier activating enzyme 3 |
| Anti-UBA3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9039 |
| UniProt: | Q8TBC4 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | YPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGEGVPLDGDDPEHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | UBA3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human cerebellum shows moderate nuclear positivity in purkinje cells. |
|
|
Immunohistochemical staining of human testis shows strong nuclear positivity. |
|
|
Immunohistochemical staining of human liver shows very weak nuclear positivity in hepatocytes. |
|
|
Immunohistochemical staining of human skin shows moderate nuclear positivity in epidermal cells. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG |
|
|
|
|
|
HPA034874-100ul |
|
|
HPA034874-100ul |
|
|
HPA034874-100ul |
Produktgarantie und fachkundiger Support
