Anti-UBA3
Catalog Number:
ATA-HPA034874
- Images (9)
| Article Name: | Anti-UBA3 |
| Biozol Catalog Number: | ATA-HPA034874 |
| Supplier Catalog Number: | HPA034874 |
| Alternative Catalog Number: | ATA-HPA034874-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | hUba3, NAE2, UBE1C |
| ubiquitin-like modifier activating enzyme 3 |
| Anti-UBA3 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 9039 |
| UniProt: | Q8TBC4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | YPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGEGVPLDGDDPEHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | UBA3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human cerebellum shows moderate nuclear positivity in purkinje cells. |
|
|
Immunohistochemical staining of human testis shows strong nuclear positivity. |
|
|
Immunohistochemical staining of human liver shows very weak nuclear positivity in hepatocytes. |
|
|
Immunohistochemical staining of human skin shows moderate nuclear positivity in epidermal cells. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG |
|
|
|
|
|
HPA034874-100ul |
|
|
HPA034874-100ul |
|
|
HPA034874-100ul |
Product Guarantee and Expert Support
