Anti-UBA3
Catalog Number:
ATA-HPA034874
| Article Name: |
Anti-UBA3 |
| Biozol Catalog Number: |
ATA-HPA034874 |
| Supplier Catalog Number: |
HPA034874 |
| Alternative Catalog Number: |
ATA-HPA034874-100 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
hUba3, NAE2, UBE1C |
| ubiquitin-like modifier activating enzyme 3 |
| Clonality: |
Polyclonal |
| Concentration: |
0.05 mg/ml |
| Isotype: |
IgG |
| NCBI: |
9039 |
| UniProt: |
Q8TBC4 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
YPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGEGVPLDGDDPEHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCA |
| Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: |
UBA3 |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
Immunohistochemical staining of human cerebellum shows moderate nuclear positivity in purkinje cells. |
|
Immunohistochemical staining of human testis shows strong nuclear positivity. |
|
Immunohistochemical staining of human liver shows very weak nuclear positivity in hepatocytes. |
|
Immunohistochemical staining of human skin shows moderate nuclear positivity in epidermal cells. |
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG |
|
|
|
HPA034874-100ul |
|
HPA034874-100ul |
|
HPA034874-100ul |