Anti-OPTC Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA034951
Artikelname: Anti-OPTC Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA034951
Hersteller Artikelnummer: HPA034951
Alternativnummer: ATA-HPA034951-100,ATA-HPA034951-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: OPTC
opticin
Anti-OPTC
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 26254
UniProt: Q9UBM4
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RIDLSNNLISSIDNDAFRLLHALQDLILPENQLEALPVLPSGIEFLDVRLNRLQSSGIQPAAFRAMEKLQFLYLSDNLLDSIP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: OPTC
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemical staining of human duodenum, eye, kidney and lymph node using Anti-OPTC antibody HPA034951 (A) shows similar protein distribution across tissues to independent antibody HPA034952 (B).
Immunohistochemical staining of human kidney using Anti-OPTC antibody HPA034951.
Immunohistochemical staining of human eye using Anti-OPTC antibody HPA034951.
Immunohistochemical staining of human duodenum using Anti-OPTC antibody HPA034951.
Immunohistochemical staining of human lymph node using Anti-OPTC antibody HPA034951.
HPA034951
HPA034951
HPA034951