Anti-OPTC Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-OPTC Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA034951
• Supplier Catalog Number: HPA034951
• Alternative Catalog Number: ATA-HPA034951-100,ATA-HPA034951-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: OPTC

Product Description

opticin

Additional Information

Anti-OPTC

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 26254
• UniProt: Q9UBM4
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: RIDLSNNLISSIDNDAFRLLHALQDLILPENQLEALPVLPSGIEFLDVRLNRLQSSGIQPAAFRAMEKLQFLYLSDNLLDSIP
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: OPTC
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500

Images

Immunohistochemical staining of human duodenum, eye, kidney and lymph node using Anti-OPTC antibody HPA034951 (A) shows similar protein distribution across tissues to independent antibody HPA034952 (B).

Immunohistochemical staining of human kidney using Anti-OPTC antibody HPA034951.

Immunohistochemical staining of human eye using Anti-OPTC antibody HPA034951.

Immunohistochemical staining of human duodenum using Anti-OPTC antibody HPA034951.

Immunohistochemical staining of human lymph node using Anti-OPTC antibody HPA034951.

HPA034951

HPA034951

HPA034951