Anti-GRK1

Artikelnummer: ATA-HPA035200
Artikelname: Anti-GRK1
Artikelnummer: ATA-HPA035200
Hersteller Artikelnummer: HPA035200
Alternativnummer: ATA-HPA035200-100,ATA-HPA035200-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: GPRK1, RHOK, RK
G protein-coupled receptor kinase 1
Anti-GRK1
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 6011
UniProt: Q15835
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: MDFGSLETVVANSAFIAARGSFDGSSSQPSRDKKYLAKLKLPPLSKCESLRDSLSLEFESVCLEQPIGKKLFQQFLQSA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: GRK1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemical staining of human colon, eye, retina, liver and lymph node using Anti-GRK1 antibody HPA035200 (A) shows similar protein distribution across tissues to independent antibody HPA059376 (B).
Immunohistochemical staining of human liver using Anti-GRK1 antibody HPA035200.
Immunohistochemical staining of human eye, retina using Anti-GRK1 antibody HPA035200.
Immunohistochemical staining of human colon using Anti-GRK1 antibody HPA035200.
Immunohistochemical staining of human lymph node using Anti-GRK1 antibody HPA035200.
HPA035200-100ul
HPA035200-100ul
HPA035200-100ul