Anti-GRK1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-GRK1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA035200
• Supplier Catalog Number: HPA035200
• Alternative Catalog Number: ATA-HPA035200-100,ATA-HPA035200-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: GPRK1, RHOK, RK

Product Description

G protein-coupled receptor kinase 1

Additional Information

Anti-GRK1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.3 mg/ml
• Isotype: IgG
• NCBI: 6011
• UniProt: Q15835
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: MDFGSLETVVANSAFIAARGSFDGSSSQPSRDKKYLAKLKLPPLSKCESLRDSLSLEFESVCLEQPIGKKLFQQFLQSA
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: GRK1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:500 - 1:1000

Images

Immunohistochemical staining of human colon, eye, retina, liver and lymph node using Anti-GRK1 antibody HPA035200 (A) shows similar protein distribution across tissues to independent antibody HPA059376 (B).

Immunohistochemical staining of human liver using Anti-GRK1 antibody HPA035200.

Immunohistochemical staining of human eye, retina using Anti-GRK1 antibody HPA035200.

Immunohistochemical staining of human colon using Anti-GRK1 antibody HPA035200.

Immunohistochemical staining of human lymph node using Anti-GRK1 antibody HPA035200.

HPA035200

HPA035200

HPA035200