Anti-DNAJC9
Artikelnummer:
ATA-HPA035216
- Bilder (6)
| Artikelname: | Anti-DNAJC9 |
| Artikelnummer: | ATA-HPA035216 |
| Hersteller Artikelnummer: | HPA035216 |
| Alternativnummer: | ATA-HPA035216-100,ATA-HPA035216-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Molekularbiologie |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | JDD1, SB73 |
| DnaJ (Hsp40) homolog, subfamily C, member 9 |
| Anti-DNAJC9 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 23234 |
| UniProt: | Q8WXX5 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DNAJC9 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm, plasma membrane & cytosol. |
|
|
Immunohistochemical staining of human urinary bladder shows strong nuclear positivity in urothelial cells. |
|
|
Western blot analysis using Anti-DNAJC9 antibody HPA035216 (A) shows similar pattern to independent antibody HPA035215 (B). |
|
|
HPA035216-100ul |
|
|
HPA035216-100ul |
|
|
HPA035216-100ul |
Produktgarantie und fachkundiger Support
