Anti-DNAJC9
Catalog Number:
ATA-HPA035216
- Images (6)
| Article Name: | Anti-DNAJC9 |
| Biozol Catalog Number: | ATA-HPA035216 |
| Supplier Catalog Number: | HPA035216 |
| Alternative Catalog Number: | ATA-HPA035216-100,ATA-HPA035216-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Molekularbiologie |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | JDD1, SB73 |
| DnaJ (Hsp40) homolog, subfamily C, member 9 |
| Anti-DNAJC9 |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 23234 |
| UniProt: | Q8WXX5 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DNAJC9 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm, plasma membrane & cytosol. |
|
|
Immunohistochemical staining of human urinary bladder shows strong nuclear positivity in urothelial cells. |
|
|
Western blot analysis using Anti-DNAJC9 antibody HPA035216 (A) shows similar pattern to independent antibody HPA035215 (B). |
|
|
HPA035216-100ul |
|
|
HPA035216-100ul |
|
|
HPA035216-100ul |
Product Guarantee and Expert Support
