Anti-MXI1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA035319
Artikelname: Anti-MXI1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA035319
Hersteller Artikelnummer: HPA035319
Alternativnummer: ATA-HPA035319-100,ATA-HPA035319-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: bHLHc11, MAD2, MXD2, MXI
MAX interactor 1, dimerization protein
Anti-MXI1
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 4601
UniProt: P50539
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: HTTLGLLNKAKAHIKKLEEAERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRM
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MXI1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.
Immunohistochemical staining of human skin shows moderate to strong nuclear positivity in epidermal cells.
Immunohistochemical staining of human colon shows moderate to strong nuclear positivity in glandular cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and MXI1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY423334).
HPA035319
HPA035319
HPA035319