Anti-MXI1 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA035319
- Images (8)
| Article Name: | Anti-MXI1 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA035319 |
| Supplier Catalog Number: | HPA035319 |
| Alternative Catalog Number: | ATA-HPA035319-100,ATA-HPA035319-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | bHLHc11, MAD2, MXD2, MXI |
| MAX interactor 1, dimerization protein |
| Anti-MXI1 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 4601 |
| UniProt: | P50539 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | HTTLGLLNKAKAHIKKLEEAERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRM |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MXI1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons. |
|
|
Immunohistochemical staining of human skin shows moderate to strong nuclear positivity in epidermal cells. |
|
|
Immunohistochemical staining of human colon shows moderate to strong nuclear positivity in glandular cells. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and MXI1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY423334). |
|
|
HPA035319 |
|
|
HPA035319 |
|
|
HPA035319 |
Product Guarantee and Expert Support
