Anti-CACNB2 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA035326
Artikelname: Anti-CACNB2 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA035326
Hersteller Artikelnummer: HPA035326
Alternativnummer: ATA-HPA035326-100,ATA-HPA035326-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CACNLB2, MYSB
calcium channel, voltage-dependent, beta 2 subunit
Anti-CACNB2
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 783
UniProt: Q08289
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RDSAYVEPKEDYSHDHVDHYASHRDHNHRDETHGSSDHRHRESRHRSRDVDREQDHNECNKQRSRHKSKDRYCEKDGEVI
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CACNB2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA035326 antibody. Corresponding CACNB2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human prostate shows weak to moderate membranous positivity in smooth muscle cells.
Immunohistochemical staining of human cerebellum shows moderate to strong membranous positivity in Purkinje cells.
Immunohistochemical staining of human cerebral cortex shows moderate to strong membranous positivity in neurons.
Immunohistochemical staining of human skeletal muscle shows very weak positivity in myocytes.
HPA035326
HPA035326
HPA035326