Anti-CACNB2 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA035326
- Images (8)
| Article Name: | Anti-CACNB2 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA035326 |
| Supplier Catalog Number: | HPA035326 |
| Alternative Catalog Number: | ATA-HPA035326-100,ATA-HPA035326-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CACNLB2, MYSB |
| calcium channel, voltage-dependent, beta 2 subunit |
| Anti-CACNB2 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 783 |
| UniProt: | Q08289 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RDSAYVEPKEDYSHDHVDHYASHRDHNHRDETHGSSDHRHRESRHRSRDVDREQDHNECNKQRSRHKSKDRYCEKDGEVI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CACNB2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA035326 antibody. Corresponding CACNB2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human prostate shows weak to moderate membranous positivity in smooth muscle cells. |
|
|
Immunohistochemical staining of human cerebellum shows moderate to strong membranous positivity in Purkinje cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong membranous positivity in neurons. |
|
|
Immunohistochemical staining of human skeletal muscle shows very weak positivity in myocytes. |
|
|
HPA035326 |
|
|
HPA035326 |
|
|
HPA035326 |
Product Guarantee and Expert Support
