Anti-CACNB2

Catalog Number: ATA-HPA035326
Article Name: Anti-CACNB2
Biozol Catalog Number: ATA-HPA035326
Supplier Catalog Number: HPA035326
Alternative Catalog Number: ATA-HPA035326-100,ATA-HPA035326-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CACNLB2, MYSB
calcium channel, voltage-dependent, beta 2 subunit
Anti-CACNB2
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 783
UniProt: Q08289
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RDSAYVEPKEDYSHDHVDHYASHRDHNHRDETHGSSDHRHRESRHRSRDVDREQDHNECNKQRSRHKSKDRYCEKDGEVI
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CACNB2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA035326 antibody. Corresponding CACNB2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human prostate shows weak to moderate membranous positivity in smooth muscle cells.
Immunohistochemical staining of human cerebellum shows moderate to strong membranous positivity in Purkinje cells.
Immunohistochemical staining of human cerebral cortex shows moderate to strong membranous positivity in neurons.
Immunohistochemical staining of human skeletal muscle shows very weak positivity in myocytes.
HPA035326
HPA035326
HPA035326