Anti-SLC25A12
Artikelnummer:
ATA-HPA035333
- Bilder (7)
| Artikelname: | Anti-SLC25A12 |
| Artikelnummer: | ATA-HPA035333 |
| Hersteller Artikelnummer: | HPA035333 |
| Alternativnummer: | ATA-HPA035333-100,ATA-HPA035333-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Aralar |
| solute carrier family 25 (aspartate/glutamate carrier), member 12 |
| Anti-SLC25A12 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8604 |
| UniProt: | O75746 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | FNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGMISGLDFSDIMV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SLC25A12 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islet cells. |
|
|
Western blot analysis using Anti-SLC25A12 antibody HPA035333 (A) shows similar pattern to independent antibody HPA035334 (B). |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA035333-100ul |
|
|
|
|
|
HPA035333-100ul |
|
|
HPA035333-100ul |
Produktgarantie und fachkundiger Support
