Anti-SLC25A12
Catalog Number:
ATA-HPA035333
- Images (7)
| Article Name: | Anti-SLC25A12 |
| Biozol Catalog Number: | ATA-HPA035333 |
| Supplier Catalog Number: | HPA035333 |
| Alternative Catalog Number: | ATA-HPA035333-100,ATA-HPA035333-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | Aralar |
| solute carrier family 25 (aspartate/glutamate carrier), member 12 |
| Anti-SLC25A12 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 8604 |
| UniProt: | O75746 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | FNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGMISGLDFSDIMV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLC25A12 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islet cells. |
|
|
Western blot analysis using Anti-SLC25A12 antibody HPA035333 (A) shows similar pattern to independent antibody HPA035334 (B). |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA035333-100ul |
|
|
|
|
|
HPA035333-100ul |
|
|
HPA035333-100ul |
Product Guarantee and Expert Support
