Anti-SLC25A12
Artikelnummer:
ATA-HPA035334
- Bilder (8)
| Artikelname: | Anti-SLC25A12 |
| Artikelnummer: | ATA-HPA035334 |
| Hersteller Artikelnummer: | HPA035334 |
| Alternativnummer: | ATA-HPA035334-100,ATA-HPA035334-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Aralar |
| solute carrier family 25 (aspartate/glutamate carrier), member 12 |
| Anti-SLC25A12 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8604 |
| UniProt: | O75746 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MAVKVQTTKRGDPHELRNIFLQYASTEVDGERYMTPEDFVQRYLGLYNDPNSNPKIVQLLAGVADQTK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SLC25A12 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human heart muscle and liver tissues using Anti-SLC25A12 antibody. Corresponding SLC25A12 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human heart muscle shows high expression. |
|
|
Western blot analysis using Anti-SLC25A12 antibody HPA035334 (A) shows similar pattern to independent antibody HPA035333 (B). |
|
|
|
|
|
HPA035334-100ul |
|
|
HPA035334-100ul |
|
|
HPA035334-100ul |
Produktgarantie und fachkundiger Support
