Anti-SLC25A12

Catalog Number: ATA-HPA035334
Article Name: Anti-SLC25A12
Biozol Catalog Number: ATA-HPA035334
Supplier Catalog Number: HPA035334
Alternative Catalog Number: ATA-HPA035334-100,ATA-HPA035334-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: Aralar
solute carrier family 25 (aspartate/glutamate carrier), member 12
Anti-SLC25A12
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 8604
UniProt: O75746
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MAVKVQTTKRGDPHELRNIFLQYASTEVDGERYMTPEDFVQRYLGLYNDPNSNPKIVQLLAGVADQTK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SLC25A12
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human heart muscle and liver tissues using Anti-SLC25A12 antibody. Corresponding SLC25A12 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human heart muscle shows high expression.
Western blot analysis using Anti-SLC25A12 antibody HPA035334 (A) shows similar pattern to independent antibody HPA035333 (B).
HPA035334-100ul
HPA035334-100ul
HPA035334-100ul