Anti-CCDC39 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA035363
Artikelname: Anti-CCDC39 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA035363
Hersteller Artikelnummer: HPA035363
Alternativnummer: ATA-HPA035363-100,ATA-HPA035363-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CILD14, DKFZp434A128, FAP59
coiled-coil domain containing 39
Anti-CCDC39
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 339829
UniProt: Q9UFE4
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TESEEHFKAIAQRELGRVKDEIQRLENEMASILEKKSDKENGIFKATQKLDGLKCQMNWDQQALEAWLEESAHKDSDALTLQKYAQQDDNKIRAL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CCDC39
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500
Immunohistochemical staining of human bronchus, fallopian tube, rectum and tonsil using Anti-CCDC39 antibody HPA035363 (A) shows similar protein distribution across tissues to independent antibody HPA035364 (B).
Immunohistochemical staining of human bronchus shows moderate positivity in cilia in glandular cells.
Immunohistochemical staining of human rectum shows no positivity in glandular cells as expected.
Immunohistochemical staining of human tonsil shows no positivity in non-germinal center cells as expected.
Immunohistochemical staining of human fallopian tube shows moderate positivity in cilia in glandular cells.
HPA035363
HPA035363
HPA035363