Anti-CCDC39 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA035363
- Images (8)
| Article Name: | Anti-CCDC39 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA035363 |
| Supplier Catalog Number: | HPA035363 |
| Alternative Catalog Number: | ATA-HPA035363-100,ATA-HPA035363-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CILD14, DKFZp434A128, FAP59 |
| coiled-coil domain containing 39 |
| Anti-CCDC39 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 339829 |
| UniProt: | Q9UFE4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | TESEEHFKAIAQRELGRVKDEIQRLENEMASILEKKSDKENGIFKATQKLDGLKCQMNWDQQALEAWLEESAHKDSDALTLQKYAQQDDNKIRAL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CCDC39 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemical staining of human bronchus, fallopian tube, rectum and tonsil using Anti-CCDC39 antibody HPA035363 (A) shows similar protein distribution across tissues to independent antibody HPA035364 (B). |
|
|
Immunohistochemical staining of human bronchus shows moderate positivity in cilia in glandular cells. |
|
|
Immunohistochemical staining of human rectum shows no positivity in glandular cells as expected. |
|
|
Immunohistochemical staining of human tonsil shows no positivity in non-germinal center cells as expected. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate positivity in cilia in glandular cells. |
|
|
HPA035363 |
|
|
HPA035363 |
|
|
HPA035363 |
Product Guarantee and Expert Support
