Anti-UBR3

Artikelnummer: ATA-HPA035390
Artikelname: Anti-UBR3
Artikelnummer: ATA-HPA035390
Hersteller Artikelnummer: HPA035390
Alternativnummer: ATA-HPA035390-100,ATA-HPA035390-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DKFZp434P117, FLJ37422, KIAA2024, ZNF650
ubiquitin protein ligase E3 component n-recognin 3 (putative)
Anti-UBR3
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 130507
UniProt: Q6ZT12
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: DRSAWKHAGALKKSTCDAEKSYEVLLSFVISELFKGKLYHEEGTQECAMVNPIAWSPESMEKCLQDFCLPFLRITSLLQHHLFGEDLPSCQE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: UBR3
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.
Immunohistochemical staining of human hippocampus shows strong cytoplasmic and nucleolar positivity in neuronal cells.
Western blot analysis in human cell line K562.
HPA035390-100ul
HPA035390-100ul
HPA035390-100ul