Anti-UBR3 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA035390
- Images (8)
| Article Name: | Anti-UBR3 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA035390 |
| Supplier Catalog Number: | HPA035390 |
| Alternative Catalog Number: | ATA-HPA035390-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DKFZp434P117, FLJ37422, KIAA2024, ZNF650 |
| ubiquitin protein ligase E3 component n-recognin 3 (putative) |
| Anti-UBR3 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 130507 |
| UniProt: | Q6ZT12 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DRSAWKHAGALKKSTCDAEKSYEVLLSFVISELFKGKLYHEEGTQECAMVNPIAWSPESMEKCLQDFCLPFLRITSLLQHHLFGEDLPSCQE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | UBR3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli. |
|
|
Immunohistochemical staining of human hippocampus shows strong cytoplasmic and nucleolar positivity in neuronal cells. |
|
|
Western blot analysis in human cell line K562. |
|
|
|
|
|
HPA035390 |
|
|
|
|
|
HPA035390 |
|
|
HPA035390 |
Product Guarantee and Expert Support
