Anti-GMPPA
Artikelnummer:
ATA-HPA035513
| Artikelname: |
Anti-GMPPA |
| Artikelnummer: |
ATA-HPA035513 |
| Hersteller Artikelnummer: |
HPA035513 |
| Alternativnummer: |
ATA-HPA035513-100,ATA-HPA035513-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Sonstiges |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
GMPPA |
| GDP-mannose pyrophosphorylase A |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.05 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
29926 |
| UniProt: |
Q96IJ6 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
TCVLHSIVGWGSTVGRWARVEGTPSDPNPNDPRARMDSESLFKDGKLLPAITILGCRVRIPAEVLILNSIVLPHKELSRSFTNQIIL |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
GMPPA |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
Immunohistochemical staining of human pancreas shows moderate to strong cytoplasmic positivity in exocrine glandular cells. |
|
Immunohistochemical staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells. |
|
Immunohistochemical staining of human tonsil shows moderate cytoplasmic positivity in lymphoid cells. |
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
|
HPA035513-100ul |
|
HPA035513-100ul |
|
HPA035513-100ul |