Anti-GMPPA

Catalog Number: ATA-HPA035513
Article Name: Anti-GMPPA
Biozol Catalog Number: ATA-HPA035513
Supplier Catalog Number: HPA035513
Alternative Catalog Number: ATA-HPA035513-100,ATA-HPA035513-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GMPPA
GDP-mannose pyrophosphorylase A
Anti-GMPPA
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 29926
UniProt: Q96IJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TCVLHSIVGWGSTVGRWARVEGTPSDPNPNDPRARMDSESLFKDGKLLPAITILGCRVRIPAEVLILNSIVLPHKELSRSFTNQIIL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: GMPPA
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human pancreas shows moderate to strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemical staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human tonsil shows moderate cytoplasmic positivity in lymphoid cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA035513-100ul
HPA035513-100ul
HPA035513-100ul