Anti-IFT57 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA035514
- Bilder (8)
| Artikelname: | Anti-IFT57 Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA035514 |
| Hersteller Artikelnummer: | HPA035514 |
| Alternativnummer: | ATA-HPA035514-100,ATA-HPA035514-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ESRRBL1, FLJ10147, HIPPI, MHS4R2 |
| intraflagellar transport 57 |
| Anti-IFT57 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 55081 |
| UniProt: | Q9NWB7 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RSFGRTADFPPSKLKSGYGEHVCYVLDCFAEEALKYIGFTWKRPIYPVEELEEESVAEDDAELTLNKVDEEFVEEETDNEENFIDLN |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | IFT57 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear speckles & cytosol. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
HPA035514 |
|
|
|
|
|
|
|
|
HPA035514 |
|
|
HPA035514 |
Produktgarantie und fachkundiger Support
