Anti-IFT57

Catalog Number: ATA-HPA035514
Article Name: Anti-IFT57
Biozol Catalog Number: ATA-HPA035514
Supplier Catalog Number: HPA035514
Alternative Catalog Number: ATA-HPA035514-100,ATA-HPA035514-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ESRRBL1, FLJ10147, HIPPI, MHS4R2
intraflagellar transport 57
Anti-IFT57
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 55081
UniProt: Q9NWB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RSFGRTADFPPSKLKSGYGEHVCYVLDCFAEEALKYIGFTWKRPIYPVEELEEESVAEDDAELTLNKVDEEFVEEETDNEENFIDLN
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: IFT57
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear speckles & cytosol.
Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA035514-100ul
HPA035514-100ul
HPA035514-100ul