Anti-KIF15
Artikelnummer:
ATA-HPA035517
- Bilder (9)
| Artikelname: | Anti-KIF15 |
| Artikelnummer: | ATA-HPA035517 |
| Hersteller Artikelnummer: | HPA035517 |
| Alternativnummer: | ATA-HPA035517-100,ATA-HPA035517-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HKLP2, KNSL7, NY-BR-62 |
| kinesin family member 15 |
| Anti-KIF15 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 56992 |
| UniProt: | Q9NS87 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ESLLATEKVISSLEKSRDSDKKVVADLMNQIQELRTSVCEKTETIDTLKQELKDINCKYNSALVDREESRVLIKKQEVDILD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | KIF15 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in Leydig cells. |
|
|
Immunohistochemical staining of human rectum shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected. |
|
|
Western blot analysis in human cell line MOLT-4. |
|
|
HPA035517-100ul |
|
|
|
|
|
HPA035517-100ul |
|
|
HPA035517-100ul |
Produktgarantie und fachkundiger Support
