Anti-KIF15
Catalog Number:
ATA-HPA035517
- Images (9)
| Article Name: | Anti-KIF15 |
| Biozol Catalog Number: | ATA-HPA035517 |
| Supplier Catalog Number: | HPA035517 |
| Alternative Catalog Number: | ATA-HPA035517-100,ATA-HPA035517-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HKLP2, KNSL7, NY-BR-62 |
| kinesin family member 15 |
| Anti-KIF15 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 56992 |
| UniProt: | Q9NS87 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ESLLATEKVISSLEKSRDSDKKVVADLMNQIQELRTSVCEKTETIDTLKQELKDINCKYNSALVDREESRVLIKKQEVDILD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | KIF15 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in Leydig cells. |
|
|
Immunohistochemical staining of human rectum shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected. |
|
|
Western blot analysis in human cell line MOLT-4. |
|
|
HPA035517-100ul |
|
|
|
|
|
HPA035517-100ul |
|
|
HPA035517-100ul |
Product Guarantee and Expert Support
