Anti-IGSF1

Artikelnummer: ATA-HPA035582
Artikelname: Anti-IGSF1
Artikelnummer: ATA-HPA035582
Hersteller Artikelnummer: HPA035582
Alternativnummer: ATA-HPA035582-100,ATA-HPA035582-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: IGCD1, IGDC1, INHBP, KIAA0364, MGC75490, PGSF2
immunoglobulin superfamily, member 1
Anti-IGSF1
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 3547
UniProt: Q8N6C5
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: IVMPTPKPELWAETNFPLAPWKNLTLWCRSPSGSTKEFVLLKDGTGWIATRPASEQVRAAFPLGALTQSHTGSYHCHSWEEMAVSEPSE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: IGSF1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemical staining of human liver, lymph node, pituitary gland and testis using Anti-IGSF1 antibody HPA035582 (A) shows similar protein distribution across tissues to independent antibody HPA012732 (B).
Immunohistochemical staining of human lymph node using Anti-IGSF1 antibody HPA035582.
Immunohistochemical staining of human pituitary gland using Anti-IGSF1 antibody HPA035582.
Immunohistochemical staining of human testis using Anti-IGSF1 antibody HPA035582.
Immunohistochemical staining of human liver using Anti-IGSF1 antibody HPA035582.
HPA035582-100ul
HPA035582-100ul
HPA035582-100ul