Anti-IGSF1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-IGSF1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA035582
• Supplier Catalog Number: HPA035582
• Alternative Catalog Number: ATA-HPA035582-100,ATA-HPA035582-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: IGCD1, IGDC1, INHBP, KIAA0364, MGC75490, PGSF2

Product Description

immunoglobulin superfamily, member 1

Additional Information

Anti-IGSF1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 3547
• UniProt: Q8N6C5
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: IVMPTPKPELWAETNFPLAPWKNLTLWCRSPSGSTKEFVLLKDGTGWIATRPASEQVRAAFPLGALTQSHTGSYHCHSWEEMAVSEPSE
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: IGSF1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunohistochemical staining of human liver, lymph node, pituitary gland and testis using Anti-IGSF1 antibody HPA035582 (A) shows similar protein distribution across tissues to independent antibody HPA012732 (B).

Immunohistochemical staining of human lymph node using Anti-IGSF1 antibody HPA035582.

Immunohistochemical staining of human pituitary gland using Anti-IGSF1 antibody HPA035582.

Immunohistochemical staining of human testis using Anti-IGSF1 antibody HPA035582.

Immunohistochemical staining of human liver using Anti-IGSF1 antibody HPA035582.

HPA035582

HPA035582

HPA035582