Anti-TRH

Artikelnummer: ATA-HPA035596
Artikelname: Anti-TRH
Artikelnummer: ATA-HPA035596
Hersteller Artikelnummer: HPA035596
Alternativnummer: ATA-HPA035596-100,ATA-HPA035596-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: TRH
thyrotropin-releasing hormone
Anti-TRH
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Isotyp: IgG
NCBI: 7200
UniProt: P20396
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: HKRQHPGRREDEASWSVDVTQHKRQHPGRRSPWLAYAVPKRQHPGRRLADPKAQRSWEE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TRH
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500
Immunohistochemistry analysis in human cervix, uterine and skeletal muscle tissues using HPA035596 antibody. Corresponding TRH RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cervix, uterine shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human endometrium shows weak to moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
HPA035596-100ul
HPA035596-100ul
HPA035596-100ul