Anti-TRH
Catalog Number:
ATA-HPA035596
- Images (8)
| Article Name: | Anti-TRH |
| Biozol Catalog Number: | ATA-HPA035596 |
| Supplier Catalog Number: | HPA035596 |
| Alternative Catalog Number: | ATA-HPA035596-100,ATA-HPA035596-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | TRH |
| thyrotropin-releasing hormone |
| Anti-TRH |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Isotype: | IgG |
| NCBI: | 7200 |
| UniProt: | P20396 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | HKRQHPGRREDEASWSVDVTQHKRQHPGRRSPWLAYAVPKRQHPGRRLADPKAQRSWEE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TRH |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human cervix, uterine and skeletal muscle tissues using HPA035596 antibody. Corresponding TRH RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cervix, uterine shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human endometrium shows weak to moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human testis shows no positivity in cells in seminiferous ducts as expected. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA035596-100ul |
|
|
HPA035596-100ul |
|
|
HPA035596-100ul |
Product Guarantee and Expert Support
