Anti-SLC4A4 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA035628
Artikelname: Anti-SLC4A4 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA035628
Hersteller Artikelnummer: HPA035628
Alternativnummer: ATA-HPA035628-100,ATA-HPA035628-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: hhNMC, HNBC1, NBC1, NBC2, pNBC, SLC4A5
solute carrier family 4 (sodium bicarbonate cotransporter), member 4
Anti-SLC4A4
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 8671
UniProt: Q9Y6R1
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SLC4A4
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human kidney and lymph node tissues using HPA035628 antibody. Corresponding SLC4A4 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Immunohistochemical staining of human pancreas shows strong membranous positivity in intercalated ducts.
Immunohistochemical staining of human lymph node shows no positivity as expected.
Immunohistochemical staining of human kidney shows strong cytoplasmic/ membranous positivity in cells in tubules.
HPA035628
HPA035628
HPA035628