Anti-SLC4A4
Artikelnummer:
ATA-HPA035628
- Bilder (8)
| Artikelname: | Anti-SLC4A4 |
| Artikelnummer: | ATA-HPA035628 |
| Hersteller Artikelnummer: | HPA035628 |
| Alternativnummer: | ATA-HPA035628-100,ATA-HPA035628-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | hhNMC, HNBC1, NBC1, NBC2, pNBC, SLC4A5 |
| solute carrier family 4 (sodium bicarbonate cotransporter), member 4 |
| Anti-SLC4A4 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8671 |
| UniProt: | Q9Y6R1 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SLC4A4 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human kidney and lymph node tissues using HPA035628 antibody. Corresponding SLC4A4 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows no positivity in cells in seminiferous ducts as expected. |
|
|
Immunohistochemical staining of human pancreas shows strong membranous positivity in intercalated ducts. |
|
|
Immunohistochemical staining of human lymph node shows no positivity as expected. |
|
|
Immunohistochemical staining of human kidney shows strong cytoplasmic/ membranous positivity in cells in tubules. |
|
|
HPA035628-100ul |
|
|
HPA035628-100ul |
|
|
HPA035628-100ul |
Produktgarantie und fachkundiger Support
