Anti-SLC4A4
Catalog Number:
ATA-HPA035628
- Images (8)
| Article Name: | Anti-SLC4A4 |
| Biozol Catalog Number: | ATA-HPA035628 |
| Supplier Catalog Number: | HPA035628 |
| Alternative Catalog Number: | ATA-HPA035628-100,ATA-HPA035628-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | hhNMC, HNBC1, NBC1, NBC2, pNBC, SLC4A5 |
| solute carrier family 4 (sodium bicarbonate cotransporter), member 4 |
| Anti-SLC4A4 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 8671 |
| UniProt: | Q9Y6R1 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLC4A4 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human kidney and lymph node tissues using HPA035628 antibody. Corresponding SLC4A4 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows no positivity in cells in seminiferous ducts as expected. |
|
|
Immunohistochemical staining of human pancreas shows strong membranous positivity in intercalated ducts. |
|
|
Immunohistochemical staining of human lymph node shows no positivity as expected. |
|
|
Immunohistochemical staining of human kidney shows strong cytoplasmic/ membranous positivity in cells in tubules. |
|
|
HPA035628-100ul |
|
|
HPA035628-100ul |
|
|
HPA035628-100ul |
Product Guarantee and Expert Support
