Anti-PAFAH1B3

Artikelnummer: ATA-HPA035639
Artikelname: Anti-PAFAH1B3
Artikelnummer: ATA-HPA035639
Hersteller Artikelnummer: HPA035639
Alternativnummer: ATA-HPA035639-100,ATA-HPA035639-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PAFAH1B3
platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa)
Anti-PAFAH1B3
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 5050
UniProt: Q15102
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PAFAH1B3
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A549 shows localization to intermediate filaments.
Immunohistochemical staining of human breast shows strong cytoplasmic and membranous positivity in glandular cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and PAFAH1B3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400914).
HPA035639
HPA035639
HPA035639