Anti-PAFAH1B3

Catalog Number: ATA-HPA035639
Article Name: Anti-PAFAH1B3
Biozol Catalog Number: ATA-HPA035639
Supplier Catalog Number: HPA035639
Alternative Catalog Number: ATA-HPA035639-100,ATA-HPA035639-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PAFAH1B3
platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa)
Anti-PAFAH1B3
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 5050
UniProt: Q15102
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PAFAH1B3
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A549 shows localization to intermediate filaments.
Immunohistochemical staining of human breast shows strong cytoplasmic and membranous positivity in glandular cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and PAFAH1B3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400914).
HPA035639-100ul
HPA035639-100ul
HPA035639-100ul