Anti-CES4A Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA035701
Artikelname: Anti-CES4A Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA035701
Hersteller Artikelnummer: HPA035701
Alternativnummer: ATA-HPA035701-100,ATA-HPA035701-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CES8, FLJ37464
carboxylesterase 4A
Anti-CES4A
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 283848
UniProt: Q5XG92
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GDPGNVTLFGQSAGAMSISGLMMSPLASGLFHRAISQSGTALFRLFITSNPLKVAKKVAHLAGCNHNSTQILVNCLRALSGTKVMRVSNKMRFLQLNFQRDPEEIIWSMSPVVDGVVIPDDPLVLLTQGKVSSVPYL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CES4A
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line PC-3 shows localization to cytosol.
Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human adrenal gland shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human smooth muscles shows no positivity as expected.
HPA035701
HPA035701
HPA035701