Anti-CES4A

Catalog Number: ATA-HPA035701
Article Name: Anti-CES4A
Biozol Catalog Number: ATA-HPA035701
Supplier Catalog Number: HPA035701
Alternative Catalog Number: ATA-HPA035701-100,ATA-HPA035701-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CES8, FLJ37464
carboxylesterase 4A
Anti-CES4A
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 283848
UniProt: Q5XG92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GDPGNVTLFGQSAGAMSISGLMMSPLASGLFHRAISQSGTALFRLFITSNPLKVAKKVAHLAGCNHNSTQILVNCLRALSGTKVMRVSNKMRFLQLNFQRDPEEIIWSMSPVVDGVVIPDDPLVLLTQGKVSSVPYL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CES4A
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line PC-3 shows localization to cytosol.
Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human adrenal gland shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human smooth muscles shows no positivity as expected.
HPA035701
HPA035701
HPA035701