Anti-CES4A Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CES4A Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA035701
• Supplier Catalog Number: HPA035701
• Alternative Catalog Number: ATA-HPA035701-100,ATA-HPA035701-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CES8, FLJ37464

Product Description

carboxylesterase 4A

Additional Information

Anti-CES4A

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 283848
• UniProt: Q5XG92
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: GDPGNVTLFGQSAGAMSISGLMMSPLASGLFHRAISQSGTALFRLFITSNPLKVAKKVAHLAGCNHNSTQILVNCLRALSGTKVMRVSNKMRFLQLNFQRDPEEIIWSMSPVVDGVVIPDDPLVLLTQGKVSSVPYL
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CES4A
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200

Images

Immunofluorescent staining of human cell line PC-3 shows localization to cytosol.

Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human adrenal gland shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human smooth muscles shows no positivity as expected.

HPA035701

HPA035701

HPA035701