Anti-MKI67IP Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA035735
- Bilder (8)
| Artikelname: | Anti-MKI67IP Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA035735 |
| Hersteller Artikelnummer: | HPA035735 |
| Alternativnummer: | ATA-HPA035735-100,ATA-HPA035735-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | NIFK, hNIFK, Nopp34 |
| nucleolar protein interacting with the FHA domain of MKI67 |
| Anti-MKI67IP |
| Klonalität: | Polyclonal |
| Konzentration: | 0.8 mg/ml |
| Isotyp: | IgG |
| NCBI: | 84365 |
| UniProt: | Q9BYG3 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | NIFK |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoli. |
|
|
Immunohistochemical staining of human fallopian tube shows nucleolar positivity in glandular cells. |
|
|
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-MKI67IP antibody. Remaining relative intensity is presented. |
|
|
HPA035735 |
|
|
|
|
|
|
|
|
HPA035735 |
|
|
HPA035735 |
Produktgarantie und fachkundiger Support
