Anti-MKI67IP

Catalog Number: ATA-HPA035735
Article Name: Anti-MKI67IP
Biozol Catalog Number: ATA-HPA035735
Supplier Catalog Number: HPA035735
Alternative Catalog Number: ATA-HPA035735-100,ATA-HPA035735-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: NIFK, hNIFK, Nopp34
nucleolar protein interacting with the FHA domain of MKI67
Anti-MKI67IP
Clonality: Polyclonal
Concentration: 0.8 mg/ml
Isotype: IgG
NCBI: 84365
UniProt: Q9BYG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEI
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: NIFK
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.
Immunohistochemical staining of human fallopian tube shows nucleolar positivity in glandular cells.
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-MKI67IP antibody. Remaining relative intensity is presented.
HPA035735-100ul
HPA035735-100ul
HPA035735-100ul