Anti-ABHD5

Artikelnummer: ATA-HPA035851
Artikelname: Anti-ABHD5
Artikelnummer: ATA-HPA035851
Hersteller Artikelnummer: HPA035851
Alternativnummer: ATA-HPA035851-100,ATA-HPA035851-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CGI-58, NCIE2
abhydrolase domain containing 5
Anti-ABHD5
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 51099
UniProt: Q8WTS1
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: MAAEEEEVDSADTGERSGWLTGWLPTWCPTSISHLKEAEEKMLKCVPCTYKKEPVRISNGNKIWTLKFSHNISNKTPLVLLHG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ABHD5
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to cytosol & vesicles.
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Western blot analysis in control (vector only transfected HEK293T lysate) and ABHD5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402485).
HPA035851-100ul
HPA035851-100ul
HPA035851-100ul