Anti-ABHD5

Catalog Number: ATA-HPA035851
Article Name: Anti-ABHD5
Biozol Catalog Number: ATA-HPA035851
Supplier Catalog Number: HPA035851
Alternative Catalog Number: ATA-HPA035851-100,ATA-HPA035851-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CGI-58, NCIE2
abhydrolase domain containing 5
Anti-ABHD5
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 51099
UniProt: Q8WTS1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MAAEEEEVDSADTGERSGWLTGWLPTWCPTSISHLKEAEEKMLKCVPCTYKKEPVRISNGNKIWTLKFSHNISNKTPLVLLHG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ABHD5
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to cytosol & vesicles.
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Western blot analysis in control (vector only transfected HEK293T lysate) and ABHD5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402485).
HPA035851-100ul
HPA035851-100ul
HPA035851-100ul