Anti-TRIM2

Artikelnummer: ATA-HPA035854
Artikelname: Anti-TRIM2
Artikelnummer: ATA-HPA035854
Hersteller Artikelnummer: HPA035854
Alternativnummer: ATA-HPA035854-100,ATA-HPA035854-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KIAA0517, RNF86
tripartite motif containing 2
Anti-TRIM2
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 23321
UniProt: Q9C040
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KASLQVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGLKHK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TRIM2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome.
Immunohistochemistry analysis in human cerebral cortex and lymph node tissues using Anti-TRIM2 antibody. Corresponding TRIM2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human lymph node shows low expression as expected.
HPA035854
HPA035854
HPA035854