Anti-TRIM2

Catalog Number: ATA-HPA035854
Article Name: Anti-TRIM2
Biozol Catalog Number: ATA-HPA035854
Supplier Catalog Number: HPA035854
Alternative Catalog Number: ATA-HPA035854-100,ATA-HPA035854-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0517, RNF86
tripartite motif containing 2
Anti-TRIM2
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 23321
UniProt: Q9C040
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KASLQVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGLKHK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TRIM2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome.
Immunohistochemistry analysis in human cerebral cortex and lymph node tissues using Anti-TRIM2 antibody. Corresponding TRIM2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human lymph node shows low expression as expected.
HPA035854
HPA035854
HPA035854