Anti-FAM162A Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA035856
- Bilder (8)
| Artikelname: | Anti-FAM162A Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA035856 |
| Hersteller Artikelnummer: | HPA035856 |
| Alternativnummer: | ATA-HPA035856-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C3orf28, E2IG5 |
| family with sequence similarity 162, member A |
| Anti-FAM162A |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 26355 |
| UniProt: | Q96A26 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SSSLRLTRSSDLKRINGFCTKPQESPGAPSRTYNRVPLHKPTDWQKKILIWSGRFKKEDEIPETVSLEMLDAAKNKMRV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FAM162A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to mitochondria. |
|
|
Immunohistochemical staining of human esophagus shows strong cytoplasmic positivity with a granular pattern in squamous epithelial cells. |
|
|
Western blot analysis using Anti-FAM162A antibody HPA035856 (A) shows similar pattern to independent antibody HPA058113 (B). |
|
|
HPA035856 |
|
|
|
|
|
|
|
|
HPA035856 |
|
|
HPA035856 |
Produktgarantie und fachkundiger Support
