Anti-FAM162A

Artikelnummer: ATA-HPA035856
Artikelname: Anti-FAM162A
Artikelnummer: ATA-HPA035856
Hersteller Artikelnummer: HPA035856
Alternativnummer: ATA-HPA035856-100,ATA-HPA035856-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C3orf28, E2IG5
family with sequence similarity 162, member A
Anti-FAM162A
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 26355
UniProt: Q96A26
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SSSLRLTRSSDLKRINGFCTKPQESPGAPSRTYNRVPLHKPTDWQKKILIWSGRFKKEDEIPETVSLEMLDAAKNKMRV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: FAM162A
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemical staining of human esophagus shows strong cytoplasmic positivity with a granular pattern in squamous epithelial cells.
Western blot analysis using Anti-FAM162A antibody HPA035856 (A) shows similar pattern to independent antibody HPA058113 (B).
HPA035856-100ul
HPA035856-100ul
HPA035856-100ul