Anti-FAM162A

Catalog Number: ATA-HPA035856
Article Name: Anti-FAM162A
Biozol Catalog Number: ATA-HPA035856
Supplier Catalog Number: HPA035856
Alternative Catalog Number: ATA-HPA035856-100,ATA-HPA035856-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C3orf28, E2IG5
family with sequence similarity 162, member A
Anti-FAM162A
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 26355
UniProt: Q96A26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SSSLRLTRSSDLKRINGFCTKPQESPGAPSRTYNRVPLHKPTDWQKKILIWSGRFKKEDEIPETVSLEMLDAAKNKMRV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FAM162A
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemical staining of human esophagus shows strong cytoplasmic positivity with a granular pattern in squamous epithelial cells.
Western blot analysis using Anti-FAM162A antibody HPA035856 (A) shows similar pattern to independent antibody HPA058113 (B).
HPA035856
HPA035856
HPA035856