Anti-FAM162A Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA035856
- Images (8)
| Article Name: | Anti-FAM162A Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA035856 |
| Supplier Catalog Number: | HPA035856 |
| Alternative Catalog Number: | ATA-HPA035856-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C3orf28, E2IG5 |
| family with sequence similarity 162, member A |
| Anti-FAM162A |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 26355 |
| UniProt: | Q96A26 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SSSLRLTRSSDLKRINGFCTKPQESPGAPSRTYNRVPLHKPTDWQKKILIWSGRFKKEDEIPETVSLEMLDAAKNKMRV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FAM162A |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to mitochondria. |
|
|
Immunohistochemical staining of human esophagus shows strong cytoplasmic positivity with a granular pattern in squamous epithelial cells. |
|
|
Western blot analysis using Anti-FAM162A antibody HPA035856 (A) shows similar pattern to independent antibody HPA058113 (B). |
|
|
HPA035856 |
|
|
|
|
|
|
|
|
HPA035856 |
|
|
HPA035856 |
Product Guarantee and Expert Support
