Anti-MUT

Artikelnummer: ATA-HPA035972
Artikelname: Anti-MUT
Artikelnummer: ATA-HPA035972
Hersteller Artikelnummer: HPA035972
Alternativnummer: ATA-HPA035972-100,ATA-HPA035972-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MUT
methylmalonyl CoA mutase
Anti-MUT
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 4594
UniProt: P22033
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SVSMTMNGAVIPVLANFIVTGEEQGVPKEKLTGTIQNDILKEFMVRNTYIFPPEPSMKIIADIFEYTAKHMPKFNSISISGYHMQEAGADAILELAYTLADGLEYSRTGLQAGLTIDEFAPRLSFFWGIG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MUT
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemical staining of human colon, kidney, liver and pancreas using Anti-MUT antibody HPA035972 (A) shows similar protein distribution across tissues to independent antibody HPA035971 (B).
Immunohistochemical staining of human colon using Anti-MUT antibody HPA035972.
Immunohistochemical staining of human kidney using Anti-MUT antibody HPA035972.
Immunohistochemical staining of human pancreas using Anti-MUT antibody HPA035972.
Immunohistochemical staining of human liver using Anti-MUT antibody HPA035972.
HPA035972-100ul
HPA035972-100ul
HPA035972-100ul