Anti-MUT

Catalog Number: ATA-HPA035972
Article Name: Anti-MUT
Biozol Catalog Number: ATA-HPA035972
Supplier Catalog Number: HPA035972
Alternative Catalog Number: ATA-HPA035972-100,ATA-HPA035972-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MUT
methylmalonyl CoA mutase
Anti-MUT
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 4594
UniProt: P22033
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SVSMTMNGAVIPVLANFIVTGEEQGVPKEKLTGTIQNDILKEFMVRNTYIFPPEPSMKIIADIFEYTAKHMPKFNSISISGYHMQEAGADAILELAYTLADGLEYSRTGLQAGLTIDEFAPRLSFFWGIG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MUT
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000
Immunohistochemical staining of human colon, kidney, liver and pancreas using Anti-MUT antibody HPA035972 (A) shows similar protein distribution across tissues to independent antibody HPA035971 (B).
Immunohistochemical staining of human colon using Anti-MUT antibody HPA035972.
Immunohistochemical staining of human kidney using Anti-MUT antibody HPA035972.
Immunohistochemical staining of human pancreas using Anti-MUT antibody HPA035972.
Immunohistochemical staining of human liver using Anti-MUT antibody HPA035972.
HPA035972-100ul
HPA035972-100ul
HPA035972-100ul