Anti-SPPL2A Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA036062
Artikelname: Anti-SPPL2A Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA036062
Hersteller Artikelnummer: HPA036062
Alternativnummer: ATA-HPA036062-100,ATA-HPA036062-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: IMP3, PSL2
signal peptide peptidase like 2A
Anti-SPPL2A
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 84888
UniProt: Q8TCT8
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: HASGNGTTKDYCMLYNPYWTALPSTLENATSISLMNLTSTPLCNLSDIPPVGIKSKAVVVPWGSCHFLE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SPPL2A
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50
Immunohistochemistry analysis in human parathyroid gland and cerebral cortex tissues using HPA036062 antibody. Corresponding SPPL2A RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human colon shows moderate membranous positivity in glandular cells.
Immunohistochemical staining of human placenta shows moderate membranous positivity in trophoblastic cells.
Immunohistochemical staining of human parathyroid gland shows moderate positivity in glandular cells.
Immunohistochemical staining of human cerebral cortex shows weak positivity.
HPA036062
HPA036062
HPA036062